PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA4G00251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 581aa    MW: 66348.1 Da    PI: 7.303
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA4G00251genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.4e-1179115339
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  AA4G00251  79 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 115
                6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-477135IPR004827Basic-leucine zipper domain
PfamPF001706.7E-879110IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77279121IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-681116No hitNo description
CDDcd147085.05E-2181132No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-782123No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.6E-29167242IPR025422Transcription factor TGA like domain
PfamPF141445.9E-23402458IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MNSTSTQFVA PRSVGIYEPM HQFVMWGDSF KGNGNMNMNS SNHFILQTNQ KLDNLSEDTS  60
HGTTGTHIFE QEASTPRNPD KIQRRLAQNR EAARKSRLRK KAYVQQLETS RLKLIQLEQE  120
LDRARQQGFY AGNGIESSSV GFSETMNPGI AAFEMEYGQW VEEQNRQICE LRTVLHGHIN  180
DIELRLLVDN AMKHYFDLFR MKSTAAKADV FFVMSGMWKT SAERFFLWIG GFRPSDLLKV  240
LLPHFDPITD QQLLDVCNLR QSCQQAEDAL SQGMDKLQYT LAESVAAGQL GDGNYIPQMA  300
SAMERLEALV SFVNQADHLR HETLQQMYRI LTTRQAARGL LALGEYFERL RALSSSWATR  360
HRVKESYSCS ISRNRRGTSS NRVSFAESHT CKLASHGLCS DLLFDNAMKH YFELFKMKST  420
AAKADVFFVM SGMWKSSAER FFLWIGGYRP SDLIKVLLPH LDPLNDQQLL DVCNLRESCQ  480
QAEDTLSHGM DKLQYTLAEN IAAEELGEGN YTPQVTSVME RFEVLVSFVN QADHLRHETL  540
QQMYRILTTR QAARGLLALG EYFQRLRSVS SSWETRHCGP T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864946.10.0predicted protein
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLD7MT940.0D7MT94_ARALL; Predicted protein
STRINGAl_scaffold_0008_30700.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein